PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Carubv10009871m
Common NameCARUB_v10009871mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family GATA
Protein Properties Length: 301aa    MW: 33355.8 Da    PI: 8.0268
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Carubv10009871mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA63.62.3e-20219253135
             GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 
                      C++C ttkTp+WR+gp+g+ktLCnaCG++yr+ +l
  Carubv10009871m 219 CTHCETTKTPQWREGPSGPKTLCNACGVRYRSGRL 253
                      *******************************9885 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004012.0E-20213263IPR000679Zinc finger, GATA-type
PROSITE profilePS5011412.281217249IPR000679Zinc finger, GATA-type
SuperFamilySSF577161.28E-15217276No hitNo description
Gene3DG3DSA:3.30.50.101.3E-15217250IPR013088Zinc finger, NHR/GATA-type
CDDcd002023.71E-17218267No hitNo description
PROSITE patternPS003440219244IPR000679Zinc finger, GATA-type
PfamPF003204.3E-18219253IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 301 aa     Download sequence    Send to blast
MNWLPEEDFK GILSDDFFDD LVDQLDCPLE DIDTTNGEGD WVAKFQDLEP PPMDMFPTLP  60
CHLTSCANAK PAPLGFHKTV PPLKHSSSSE ALSGINSTLL QSSPPPDIKV SKMFQSLSPV  120
SVFVSSCDSL SPQNSRSQGL AFPVKGMRSK RKRPTTLRFS YLLPFEPRMP EKLTPGESGS  180
ESYHSSEQHA KKKRKIQLTT HTVSSSFEAS NSDGIVRKCT HCETTKTPQW REGPSGPKTL  240
CNACGVRYRS GRLVPEYRPA SSPTFIPSLH SNSHRKIIEM RRKDDNQFDT SMMHVVISGA  300
*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00130DAPTransfer from AT1G08010Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006304051.10.0hypothetical protein CARUB_v10009871mg
RefseqXP_006304052.10.0hypothetical protein CARUB_v10009871mg
SwissprotQ6DBP81e-164GAT11_ARATH; GATA transcription factor 11
TrEMBLR0IF880.0R0IF88_9BRAS; Uncharacterized protein
STRINGAT1G08010.11e-162(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM16812589
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G08010.21e-149GATA transcription factor 11